Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TTC27 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | TTC27 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP179659
|
Novus Biologicals
NBP179659 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
TTC27 Polyclonal specifically detects TTC27 in Human samples. It is validated for Western Blot.Specifications
| TTC27 | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| FLJ20272, tetratricopeptide repeat domain 27, tetratricopeptide repeat protein 27, TPR repeat protein 27 | |
| TTC27 | |
| IgG | |
| Affinity Purified | |
| 97 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| NP_060205 | |
| 55622 | |
| Synthetic peptide directed towards the N terminal of human TTC27The immunogen for this antibody is TTC27. Peptide sequence KDQLDIAKDISQLQIDLTGALGKRTRFQENYVAQLILDVRREGDVLSNCE. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title