Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
EMC2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$482.50
Specifications
Applications | Western Blot |
---|---|
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Regulatory Status | RUO |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP156927
|
Novus Biologicals
NBP156927 |
100 μL |
Each of 1 for $482.50
|
|
|||||
Description
EMC2 Polyclonal specifically detects EMC2 in Human samples. It is validated for Western Blot.Specifications
Western Blot | |
Unconjugated | |
RUO | |
9694 | |
Synthetic peptides corresponding to TTC35(tetratricopeptide repeat domain 35) The peptide sequence was selected from the middle region of TTC35. Peptide sequence IQLYDRILQEDPTNTAARKRKIAIRKAQGKNVEAIRELNEYLEQFVGDQE. | |
Primary |
Polyclonal | |
Rabbit | |
Q15006 | |
EMC2 | |
IgG |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title