Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

TULP2 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP31030225UL

 View more versions of this product

Catalog No. NB125506

Add to cart



TULP2 Polyclonal specifically detects TULP2 in Human samples. It is validated for Western Blot.


PBS buffer, 2% sucrose
Cancer/testis antigen 65, CT65cancer testis antigen 65, tubby like protein 2, Tubby-like protein 2, TUBL2tubby-related protein 2
The immunogen is a synthetic peptide directed towards the middle region of human TULP2 (NP_003314). Peptide sequence RKRRRSKTSNYLISLDPTLLSRDGDNFVGKVRSNVFSTKFTIFDNGVNPD
25 μg
Western Blot
Western Blot 1.0 ug/ml
Affinity purified
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Product Certifications


Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit