Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TUSC4 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | TUSC4 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP179376
|
Novus Biologicals
NBP179376 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
TUSC4 Polyclonal specifically detects TUSC4 in Human samples. It is validated for Western Blot.Specifications
| TUSC4 | |
| Polyclonal | |
| Rabbit | |
| Cell Cycle and Replication | |
| NP_006536 | |
| 10641 | |
| Synthetic peptide directed towards the middle region of human TUSC4The immunogen for this antibody is TUSC4. Peptide sequence SLSPGTTVRDLIGRHPQQLQHVDERKLIQFGLMKNLIRRLQKYPVRVTRE. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| G21 protein, Gene 21 protein, homologous to yeast nitrogen permease (candidate tumor suppressor), nitrogen permease regulator 2-like protein, nitrogen permease regulator-like 2 (S. cerevisiae), NPR2, NPR2L2810446G01Rik, NPRL2, Tumor suppressor candidate 4NPR2-like protein, TUSC4 | |
| NPRL2 | |
| IgG | |
| Affinity Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title