Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TXNDC16 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$204.00 - $482.50
Specifications
Antigen | TXNDC16 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP19133920
|
Novus Biologicals
NBP19133920UL |
20 μL |
Each for $204.00
|
|
|||||
NBP191339
|
Novus Biologicals
NBP191339 |
100 μL |
Each for $482.50
|
|
|||||
Description
TXNDC16 Polyclonal specifically detects TXNDC16 in Human samples. It is validated for Western Blot.Specifications
TXNDC16 | |
Polyclonal | |
Rabbit | |
NP_065835 | |
57544 | |
Synthetic peptide directed towards the N terminal of human TXNDC16. Peptide sequence EVAEDPQQVSTVHLQLGLPLVFIVSQQATYEADRRTAEWVAWRLLGKAGV. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
KIAA1344, thioredoxin domain containing 16, thioredoxin domain-containing protein 16 | |
TXNDC16 | |
IgG |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title