Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

TXNL6 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$106.19 - $320.71

Specifications

Antigen TXNL6
Dilution Western Blot 1.0 ug/ml
Applications Western Blot
Conjugate Unconjugated
Format Purified
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NB123814
View Documents
Novus Biologicals
NBP30945625UL
25 μg
Each for $106.19
Add to cart
 
NB123813
View Documents
Novus Biologicals
NBP309456100UL
100 μg
Each for $320.71
Add to cart
 
Description

Description

TXNL6 Polyclonal antibody specifically detects TXNL6 in Human samples. It is validated for Western Blot
Specifications

Specifications

TXNL6
Western Blot
Purified
RUO
PBS buffer, 2% sucrose
115861
Polyclonal
Affinity purified
Western Blot 1.0 ug/ml
Unconjugated
Rabbit
Human
nucleoredoxin-like 1, nucleoredoxin-like protein 1, RDCVF, rod-derived cone viability factor, thioredoxin-like 6, Thioredoxin-like protein 6, TXNL6
The immunogen is a synthetic peptide directed towards the N-terminal region of Human TXNL6 (NP_612463). Peptide sequence LTDEFYVLRAAQLALVYVSQDSTEEQQDLFLKDMPKKWLFLPFEDDLRRD
Primary
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit