Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

TYRP1 Mouse anti-Human, Clone: CL4923, Novus Biologicals™

Mouse Monoclonal Antibody

Manufacturer:  Novus Biologicals NBP261642

Catalog No. NBP261642


Add to cart

Description

Description

TYRP1 Monoclonal antibody specifically detects TYRP1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications

Specifications

TYRP1
CL4923
Western Blot 1 ug/ml, Immunohistochemistry 1:1000 - 1:2500
Purified
TYRP1
This antibody was developed against a recombinant protein corresponding to amino acids: VCDICTDDLMGSRSNFDSTLISPNSVFSQWRVVCDSLEDYDTLGTLCNSTEDGPIRRNPAGNVARPMVQRLPEPQDVAQCLEVGLFDTPPFYSNSTNSFRNTVEGYSDPTGKYDPAVRSLH
Protein A purified
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Monoclonal
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunohistochemistry, Western Blot
Unconjugated
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
b-PROTEIN, CAS25,6-dihydroxyindole-2-carboxylic acid oxidase, Catalase B, CATB, EC 1.14.18, EC 1.14.18.-, EC 1.14.18.1, Glycoprotein 75, GP75DHICA oxidase, Melanoma antigen gp75, TRP-1, TRPTYRP, tyrosinase-related protein 1TRP1, TYRRP
Mouse
IgG1
100 ul
Primary
7306
Human
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit