Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

U2AF2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP258989

Catalog No. NBP258989

Add to Cart



U2AF2 Polyclonal specifically detects U2AF2 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.


Western Blot 0.4 ug/ml, Immunocytochemistry/Immunofluorescence 1-4 ug/ml
hU2AF(65), hU2AF65, splicing factor U2AF 65 kD subunit, splicing factor U2AF 65 kDa subunit, U2 (RNU2) small nuclear RNA auxiliary factor 2, U2 auxiliary factor 65 kDa subunit, U2 small nuclear ribonucleoprotein auxiliary factor (65kD), U2 small nuclear RNA auxiliary factor 2, U2AF65U2 snRNP auxiliary factor large subunit
Affinity Purified
Western Blot, Immunocytochemistry, Immunofluorescence
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LTRGAKEEHGGLIRSPRHEKKKKVRKYWDVPPPGFEHITPMQYKAMQAAGQIPATALLPTMTPDGLAVTPTPVPVVGSQMTRQARRLYVGNIPFGITEEA
100 μL
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Product Suggestions

Product Suggestions



Product Certifications


Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only