UbcH8/Ube2L6 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP15503720UL

Catalog No. NBP15503720

Description

UbcH8/Ube2L6 Polyclonal specifically detects UbcH8/Ube2L6 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: UbcH8/Ube2L6
• Classification: Polyclonal
• Dilution: Western Blot 1:100-1:2000
• Gene Accession No.: O14933
• Gene Symbols: UBE2L6
• Immunogen: Synthetic peptides corresponding to UBE2L6(ubiquitin-conjugating enzyme E2L 6) The peptide sequence was selected from the middle region of UBE2L6. Peptide sequence QVLEALNVLVNRPNIREPLRMDLADLLTQNPELFRKNAEEFTLRFGVDRP.
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Isotype: IgG

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS & 2% Sucrose. with No Preservative
• Gene Alias: EC 6.3.2.19, retinoic acid induced gene B protein, Retinoic acid-induced gene B protein, RIG-B, UbcH8, UBCH8MGC40331, Ubiquitin carrier protein L6, ubiquitin/ISG15-conjugating enzyme E2 L6, ubiquitin-conjugating enzyme E2L 6, Ubiquitin-protein ligase L6
• Host Species: Rabbit
• Molecular Weight of Antigen: 18 kDa
• Quantity: 20 μL
• Research Discipline: Stem Cell Markers
• Gene ID (Entrez): 9246
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.