Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
UbcH8/Ube2L6 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP155037
Description
UbcH8/Ube2L6 Polyclonal specifically detects UbcH8/Ube2L6 in Human samples. It is validated for Western Blot.Specifications
UbcH8/Ube2L6 | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
O14933 | |
UBE2L6 | |
Synthetic peptides corresponding to UBE2L6(ubiquitin-conjugating enzyme E2L 6) The peptide sequence was selected from the middle region of UBE2L6. Peptide sequence QVLEALNVLVNRPNIREPLRMDLADLLTQNPELFRKNAEEFTLRFGVDRP. | |
Affinity Purified | |
RUO | |
Primary | |
Bovine: 83%; Rat: 79%; Canine: 75%. | |
Human, Mouse, Rat, Porcine, Bovine, Canine, Rabbit | |
IgG |
Western Blot | |
Unconjugated | |
PBS & 2% Sucrose. with 0.09% Sodium Azide | |
EC 6.3.2.19, retinoic acid induced gene B protein, Retinoic acid-induced gene B protein, RIG-B, UbcH8, UBCH8MGC40331, Ubiquitin carrier protein L6, ubiquitin/ISG15-conjugating enzyme E2 L6, ubiquitin-conjugating enzyme E2L 6, Ubiquitin-protein ligase L6 | |
Rabbit | |
18 kDa | |
100 μL | |
Stem Cell Markers | |
9246 | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title