Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

UbcH8/Ube2L6 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$152.22 - $436.00

Specifications

Antigen UbcH8/Ube2L6
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP15503720
View Documents
Novus Biologicals
NBP15503720UL
20 μL
Each for $152.22
Add to cart
 
NBP155037
View Documents
Novus Biologicals
NBP155037
100 μL
Each for $436.00
Add to cart
 
Description

Description

UbcH8/Ube2L6 Polyclonal specifically detects UbcH8/Ube2L6 in Human samples. It is validated for Western Blot.
Specifications

Specifications

UbcH8/Ube2L6
Polyclonal
Rabbit
Stem Cell Markers
EC 6.3.2.19, retinoic acid induced gene B protein, Retinoic acid-induced gene B protein, RIG-B, UbcH8, UBCH8MGC40331, Ubiquitin carrier protein L6, ubiquitin/ISG15-conjugating enzyme E2 L6, ubiquitin-conjugating enzyme E2L 6, Ubiquitin-protein ligase L6
UBE2L6
IgG
Affinity Purified
18 kDa
Western Blot
Unconjugated
RUO
O14933
9246
Synthetic peptides corresponding to UBE2L6(ubiquitin-conjugating enzyme E2L 6) The peptide sequence was selected from the middle region of UBE2L6. Peptide sequence QVLEALNVLVNRPNIREPLRMDLADLLTQNPELFRKNAEEFTLRFGVDRP.
Primary
Store at -20C. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit