Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

UBE2N/Ubc13 Rabbit, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP154894

 View more versions of this product

Catalog No. NBP154894

This item has been discontinued by the manufacturer and is no longer available. Please call customer service for assistance: 1-800-766-7000.


Description

Description

UBE2N/Ubc13 Polyclonal antibody specifically detects Antigen in Human, Mouse, Non-species specific samples. It is validated for Immunocytochemistry/Immunofluorescence, Western Blotting.
Specifications

Specifications

UBE2N/Ubc13
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Purified
UBE2N
Synthetic peptides corresponding to UBE2N (ubiquitin-conjugating enzyme E2N (UBC13 homolog, yeast)) The peptide sequence was selected from the middle region of UBE2N. Peptide sequence GRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAEQWKTNE.
17 kDa
100ul
Cancer
Primary
7334
Human, Mouse, Non-species specific
Immunocytochemistry, Immunofluorescence, Immunohistochemistry, Western Blot
Western Blot 1:100-1:2000, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1:10-1:2000
P61088
bendless-like ubiquitin conjugating enzyme, Bendless-like ubiquitin-conjugating enzyme, BLU, EC 6.3.2.19, MGC131857, MGC8489, UBC13, UbcH-ben, Ubiquitin carrier protein N, ubiquitin-conjugating enzyme E2 N, ubiquitin-conjugating enzyme E2N (homologous to yeast UBC13), ubiquitin-conjugating enzyme E2N (UBC13 homolog, yeast), Ubiquitin-protein ligase N, yeast UBC13 homolog
Rabbit
IgG
Protein A purified
RUO
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit