Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

UBE2S Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$436.00

Specifications

Antigen UBE2S
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 1
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP155056
View Documents
Novus Biologicals
NBP155056
100 μL
Each of 1 for $436.00
Add to cart
 
Description

Description

UBE2S Polyclonal specifically detects UBE2S in Human samples. It is validated for Western Blot.
Specifications

Specifications

UBE2S
Polyclonal
Rabbit
Q16763
27338
Synthetic peptides corresponding to UBE2S(ubiquitin-conjugating enzyme E2S) The peptide sequence was selected from the N terminal of UBE2S (NP_055316). Peptide sequence NSNVENLPPHIIRLVYKEVTTLTADPPDGIKVFPNEEDLTDLQVTIEGPE.
Primary
Store at -20C. Avoid freeze-thaw cycles.
Western Blot
Unconjugated
RUO
E2-EPF5, E2-EPFEC 6.3.2.19, E2EPFEPF5, Ubiquitin carrier protein S, ubiquitin-conjugating enzyme E2 S, ubiquitin-conjugating enzyme E2-24 kD, Ubiquitin-conjugating enzyme E2-24 kDa, Ubiquitin-conjugating enzyme E2-EPF5, ubiquitin-conjugating enzyme E2S, Ubiquitin-protein ligase S
UBE2S
IgG
Affinity Purified
24 kDa
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit