Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
UBE2S Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$482.50
Specifications
| Antigen | UBE2S |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP155056
|
Novus Biologicals
NBP155056 |
100 μL |
Each of 1 for $482.50
|
|
|||||
Description
UBE2S Polyclonal specifically detects UBE2S in Human samples. It is validated for Western Blot.Specifications
| UBE2S | |
| Polyclonal | |
| Rabbit | |
| Q16763 | |
| 27338 | |
| Synthetic peptides corresponding to UBE2S(ubiquitin-conjugating enzyme E2S) The peptide sequence was selected from the N terminal of UBE2S (NP_055316). Peptide sequence NSNVENLPPHIIRLVYKEVTTLTADPPDGIKVFPNEEDLTDLQVTIEGPE. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| E2-EPF5, E2-EPFEC 6.3.2.19, E2EPFEPF5, Ubiquitin carrier protein S, ubiquitin-conjugating enzyme E2 S, ubiquitin-conjugating enzyme E2-24 kD, Ubiquitin-conjugating enzyme E2-24 kDa, Ubiquitin-conjugating enzyme E2-EPF5, ubiquitin-conjugating enzyme E2S, Ubiquitin-protein ligase S | |
| UBE2S | |
| IgG | |
| 24 kDa |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title