Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
UBLCP1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
Antigen | UBLCP1 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP155421
|
Novus Biologicals
NBP155421 |
100 μL |
Each of 1 for $436.00
|
|
Description
UBLCP1 Polyclonal specifically detects UBLCP1 in Human, Mouse samples. It is validated for Western Blot.Specifications
UBLCP1 | |
Polyclonal | |
Rabbit | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
CPUB1, CTD phosphatase-like with ubiquitin domain 1, CTD-like phosphatase domain-containing protein, EC 3.1.3.16, FLJ25267, MGC10067, ubiquitin-like domain containing CTD phosphatase 1, ubiquitin-like domain-containing CTD phosphatase 1 | |
UBLCP1 | |
IgG | |
Affinity Purified | |
37 kDa |
Western Blot | |
Unconjugated | |
RUO | |
Q8WVY7 | |
134510 | |
Synthetic peptides corresponding to UBLCP1(ubiquitin-like domain containing CTD phosphatase 1) The peptide sequence was selected from the N terminal of UBLCP1. Peptide sequence MALPIIVKWGGQEYSVTTLSEDDTVLDLKQFLKTLTGVLPERQKLLGLKV. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title