Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

UBLCP1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$436.00

Specifications

Antigen UBLCP1
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 1
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP155421
View Documents
Novus Biologicals
NBP155421
100 μL
Each of 1 for $436.00
Add to cart
 
Description

Description

UBLCP1 Polyclonal specifically detects UBLCP1 in Human, Mouse samples. It is validated for Western Blot.
Specifications

Specifications

UBLCP1
Polyclonal
Rabbit
PBS and 2% Sucrose with 0.09% Sodium Azide
CPUB1, CTD phosphatase-like with ubiquitin domain 1, CTD-like phosphatase domain-containing protein, EC 3.1.3.16, FLJ25267, MGC10067, ubiquitin-like domain containing CTD phosphatase 1, ubiquitin-like domain-containing CTD phosphatase 1
UBLCP1
IgG
Affinity Purified
37 kDa
Western Blot
Unconjugated
RUO
Q8WVY7
134510
Synthetic peptides corresponding to UBLCP1(ubiquitin-like domain containing CTD phosphatase 1) The peptide sequence was selected from the N terminal of UBLCP1. Peptide sequence MALPIIVKWGGQEYSVTTLSEDDTVLDLKQFLKTLTGVLPERQKLLGLKV.
Primary
Store at -20C. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit