Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

UBR1 Antibody, Novus Biologicals™

Name: UBR1 Antibody, Novus Biologicals&trade;
Brand: Novus Biologicals
SKU: NBP15497620
Price: 204.00 USD

Rabbit Polyclonal Antibody

Supplier: Novus Biologicals NBP15497620UL

View more versions of this product

Catalog No. NBP15497620

$204.00 / Each of 1

Qty

Add to Cart

Description

UBR1 Polyclonal specifically detects UBR1 in Human samples. It is validated for Western Blot.

Specifications

Antigen	UBR1
Classification	Polyclonal
Dilution	Western Blot 1:100-1:2000
Gene Accession No.	Q8IWV7
Gene Symbols	UBR1
Immunogen	Synthetic peptides corresponding to UBR1(ubiquitin protein ligase E3 component n-recognin 1) The peptide sequence was selected from the N terminal of UBR1. Peptide sequence YKQLQKEYISDDHDRSISITALSVQMFTVPTLARHLIEEQNVISVITETL.
Purification Method	Affinity Purified
Regulatory Status	RUO
Gene ID (Entrez)	197131
Content And Storage	Store at -20C. Avoid freeze-thaw cycles.

Applications	Western Blot
Conjugate	Unconjugated
Formulation	PBS & 2% Sucrose. with No Preservative
Gene Alias	E3 ubiquitin-protein ligase UBR1, E3a ligase, EC 6.3.2.-, JBS, MGC142065, MGC142067, N-recognin-1, ubiquitin ligase E3 alpha-I, ubiquitin protein ligase E3 component n-recognin 1, ubiquitin-protein ligase E3-alpha, Ubiquitin-protein ligase E3-alpha-1, Ubiquitin-protein ligase E3-alpha-I
Host Species	Rabbit
Molecular Weight of Antigen	200 kDa
Quantity	20 μL
Primary or Secondary	Primary
Target Species	Human
Isotype	IgG

Product Suggestions

Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

Full Name:

Email Address:*

User Name:

Telephone Number:

What type of issue did you experience with the content on the page?*

Please provide a detailed description of the issue or request*

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Spot an opportunity for improvement?

Provide Content Correction

UBR1 Antibody, Novus Biologicals™

Description

Specifications

Product Suggestions

Documents

Promotions