Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
UBR1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
| Antigen | UBR1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15497620
|
Novus Biologicals
NBP15497620UL |
20 μL |
Each for $152.22
|
|
NBP154976
|
Novus Biologicals
NBP154976 |
100 μL |
Each for $436.00
|
|
Description
UBR1 Polyclonal specifically detects UBR1 in Human samples. It is validated for Western Blot.Specifications
| UBR1 | |
| Polyclonal | |
| Rabbit | |
| Q8IWV7 | |
| 197131 | |
| Synthetic peptides corresponding to UBR1(ubiquitin protein ligase E3 component n-recognin 1) The peptide sequence was selected from the N terminal of UBR1. Peptide sequence YKQLQKEYISDDHDRSISITALSVQMFTVPTLARHLIEEQNVISVITETL. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| E3 ubiquitin-protein ligase UBR1, E3a ligase, EC 6.3.2.-, JBS, MGC142065, MGC142067, N-recognin-1, ubiquitin ligase E3 alpha-I, ubiquitin protein ligase E3 component n-recognin 1, ubiquitin-protein ligase E3-alpha, Ubiquitin-protein ligase E3-alpha-1, Ubiquitin-protein ligase E3-alpha-I | |
| UBR1 | |
| IgG | |
| Affinity Purified | |
| 200 kDa |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title