Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
UBR7 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP154339
Description
UBR7 Polyclonal specifically detects UBR7 in Human samples. It is validated for Western Blot.Specifications
| UBR7 | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| C14orf130, chromosome 14 open reading frame 130, EC 6.3.2.-, FLJ10483, MGC9518, N-recognin-7, putative E3 ubiquitin-protein ligase UBR7, ubiquitin protein ligase E3 component n-recognin 7 (putative) | |
| Rabbit | |
| 48 kDa | |
| 100 μL | |
| Primary | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml | |
| Q8N806 | |
| UBR7 | |
| Synthetic peptides corresponding to C14ORF130 The peptide sequence was selected from the N terminal of C14ORF130. Peptide sequence MAGAEGAAGRQSELEPVVSLVDVLEEDEELENEACAVLGGSDSEKCSYSQ. | |
| Affinity purified | |
| RUO | |
| 55148 | |
| Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Yeast, Zebrafish | |
| IgG |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction