Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

UBR7 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP15433920UL

 View more versions of this product

Catalog No. NBP15433920


Add to cart

Description

Description

UBR7 Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Western Blotting.
Specifications

Specifications

UBR7
Unconjugated
PBS & 2% Sucrose. with No Preservative
Affinity Purified
UBR7
Synthetic peptides corresponding to C14ORF130 The peptide sequence was selected from the N terminal of C14ORF130. Peptide sequence MAGAEGAAGRQSELEPVVSLVDVLEEDEELENEACAVLGGSDSEKCSYSQ.
48 kDa
20ul
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Human
Western Blot
Western Blot 1:100-1:2000
Q8N806
C14orf130, chromosome 14 open reading frame 130, EC 6.3.2.-, FLJ10483, MGC9518, N-recognin-7, putative E3 ubiquitin-protein ligase UBR7, ubiquitin protein ligase E3 component n-recognin 7 (putative)
Rabbit
IgG
Immunogen affinity purified
RUO
Primary
55148
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit