Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
UFM1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | UFM1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP179760
|
Novus Biologicals
NBP179760 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
UFM1 Polyclonal specifically detects UFM1 in Human samples. It is validated for Western Blot.Specifications
| UFM1 | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| bA131P10.1, BM-002, C13orf20, chromosome 13 open reading frame 20, ubiquitin-fold modifier 1 | |
| UFM1 | |
| IgG | |
| Affinity Purified | |
| 9 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| NP_057701 | |
| 51569 | |
| Synthetic peptide directed towards the middle region of human UFM1The immunogen for this antibody is UFM1. Peptide sequence LSVPESTPFTAVLKFAAEEFKVPAATSAIITNDGIGINPAQTAGNVFLKH. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title