Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
UFSP2 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | UFSP2 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP170740
|
Novus Biologicals
NBP170740 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
UFSP2 Polyclonal specifically detects UFSP2 in Human samples. It is validated for Western Blot.Specifications
| UFSP2 | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| 55325 | |
| Synthetic peptides corresponding to C4ORF20 The peptide sequence was selected from the middle region of C4ORF20. Peptide sequence YHHYMQDRIDDNGWGCAYRSLQTICSWFKHQGYTERSIPTHREIQQALVD. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| FLJ11200, UFM1-specific peptidase 2, ufm1-specific protease 2 | |
| UFSP2 | |
| IgG | |
| Affinity Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title