Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
UGT1A7 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP19133520UL
Description
UGT1A7 Polyclonal specifically detects UGT1A7 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
UGT1A7 | |
Polyclonal | |
Western Blot 1:1000, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence | |
NP_061950 | |
UGT1A7 | |
Synthetic peptide directed towards the N terminal of human UGT1A7. Peptide sequence VKTYSTSYTLEDQDREFMVFADARWTAPLRSAFSLLTSSSNGIFDLFFSN. | |
20 μL | |
Primary | |
Human | |
IgG |
Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
GNT1, polypeptide A7, UDP glucuronosyltransferase 1 family, polypeptide A7, UDP-glucuronosyltransferase 1-7, UDP-glucuronosyltransferase 1-G, UDPGT 1-7, UGT1, UGT1-07, UGT1G | |
Rabbit | |
Affinity Purified | |
RUO | |
54577 | |
Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction