Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

UGT2B28 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$104.00 - $345.50

Specifications

Antigen UGT2B28
Dilution Western Blot 1.0 ug/ml
Applications Western Blot
Conjugate Unconjugated
Format Purified
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NB120141
View Documents
Novus Biologicals
NBP310997100UL
100 μg
Each for $345.50
Add to cart
 
NB120142
View Documents
Novus Biologicals
NBP31099725UL
25 μg
Each for $104.00
Add to cart
 
Description

Description

UGT2B28 Polyclonal antibody specifically detects UGT2B28 in Mouse samples. It is validated for Western Blot
Specifications

Specifications

UGT2B28
Western Blot
Purified
RUO
PBS buffer, 2% sucrose
54490
Polyclonal
Affinity purified
Western Blot 1.0 ug/ml
Unconjugated
Rabbit
Mouse
EC 2.4.1.17, UDP Glucuronosyltransferase 2 Family, Polypeptide B28, UDP Glycosyltransferase 2 Family, Polypeptide B28, UDP-Glucuronosyltransferase 2B28, UDPGT 2B28
The immunogen is a synthetic peptide directed towards the middle region of mouse UGT2B28. Peptide sequence KVLWKFDGKTPATLGHNTRVYKWLPQNDLLGHPKTKAFVTHGGANGVYEA
Primary
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit