Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
UNC50 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15966520UL
Description
UNC50 Polyclonal specifically detects UNC50 in Human samples. It is validated for Western Blot.Specifications
UNC50 | |
Polyclonal | |
Western Blot 0.2-1 ug/ml | |
Q53HI1 | |
UNC50 | |
Synthetic peptides corresponding to UNC50(unc-50 homolog (C. elegans)) The peptide sequence was selected from the N terminal of UNC50. Peptide sequence LPSTSVNSLVQGNGVLNSRDAARHTAGAKRYKYLRRLFRFRQMDFEFAAW. | |
Affinity Purified | |
RUO | |
25972 | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
geal-6 membrane-associated high-copy suppressor 1, GMH1, hGMH1, PDLs22, Periodontal ligament-specific protein 22, Protein GMH1 homolog, protein unc-50 homolog, unc-50 homolog (C. elegans), unc-50 related, UNCLDKFZp564G0222, Uncoordinated-like protein, URP | |
Rabbit | |
30 kDa | |
20 μL | |
Primary | |
Human | |
IgG |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction