Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
UNC50 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
Antigen | UNC50 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP15966520
|
Novus Biologicals
NBP15966520UL |
20 μL |
Each for $152.22
|
|
NBP159665
|
Novus Biologicals
NBP159665 |
100 μL |
Each for $436.00
|
|
Description
UNC50 Polyclonal specifically detects UNC50 in Human samples. It is validated for Western Blot.Specifications
UNC50 | |
Polyclonal | |
Rabbit | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
geal-6 membrane-associated high-copy suppressor 1, GMH1, hGMH1, PDLs22, Periodontal ligament-specific protein 22, Protein GMH1 homolog, protein unc-50 homolog, unc-50 homolog (C. elegans), unc-50 related, UNCLDKFZp564G0222, Uncoordinated-like protein, URP | |
UNC50 | |
IgG | |
Affinity Purified | |
30 kDa |
Western Blot | |
Unconjugated | |
RUO | |
Q53HI1 | |
25972 | |
Synthetic peptides corresponding to UNC50(unc-50 homolog (C. elegans)) The peptide sequence was selected from the N terminal of UNC50. Peptide sequence LPSTSVNSLVQGNGVLNSRDAARHTAGAKRYKYLRRLFRFRQMDFEFAAW. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title