Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

URI Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP179413

 View more versions of this product

Catalog No. NBP179413

Add to cart



URI Polyclonal antibody specifically detects URI in Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit samples. It is validated for Western Blot.


PBS and 2% Sucrose with 0.09% Sodium Azide
chromosome 19 open reading frame 2, FLJ10575, NNX3RPB5-mediating protein, Protein NNX3, RMPunconventional prefoldin RPB5 interactor, RNA polymerase II subunit 5-mediating protein, URIRNA polymerase II, subunit 5-mediating protein
100 ul
Store at -20C. Avoid freeze-thaw cycles.
Expected identity based on immunogen sequence: Rabbit: 100%; Equine: 85%.
Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat
Western Blot
Western Blot 1:1000
Affinity Purified
Synthetic peptide directed towards the middle region of human C19orf2. Peptide sequence NGEYVPRKSILKSRSRENSVCSDTSESSAAEFDDRRGVLRSISCEEATCS.
Immunogen affinity purified
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit