Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

USP9Y Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP17974920UL

 View more versions of this product

Catalog No. NBP17974920


Add to cart

Description

Description

USP9Y Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Western Blotting.
Specifications

Specifications

USP9Y
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Affinity Purified
USP9Y
Synthetic peptide directed towards the C terminal of human USP9YThe immunogen for this antibody is USP9Y. Peptide sequence PHSPASQYQQNNHVHGQPYTGPAAHHLNNPQKTGQRTQENYEGNEEVSSP.
291 kDa
20ul
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Human
Western Blot
Western Blot 1:1000
NP_004645
Deubiquitinating enzyme FAF-Y, DFFRYFLJ33043, EC 3.1.2.15, EC 3.4.19.12, Fat facets protein-related, Y-linked, probable ubiquitin carboxyl-terminal hydrolase FAF-Y, ubiquitin specific peptidase 9, Y-linked, ubiquitin specific peptidase 9, Y-linked (fat facets-like, Drosophila), ubiquitin thioesterase FAF-Y, Ubiquitin thiolesterase FAF-Y, ubiquitin-specific processing protease FAF-Y, Ubiquitin-specific protease 9, Y chromosome, Ubiquitin-specific-processing protease FAF-Y
Rabbit
IgG
Immunogen affinity purified
RUO
Primary
8287
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit