UTP18 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP310541100UL

Catalog No. NB125983

Description

UTP18 Polyclonal specifically detects UTP18 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: UTP18
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin
• Gene Alias: CGI-48, U3 small nucleolar RNA-associated protein 18 homolog, UTP18, small subunit (SSU) processome component, homolog (yeast), WD repeat domain 50, WD repeat-containing protein 50, WDR50
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human UTP18 (NP_057085). Peptide sequence PARPSAAAAAIAVAAAEEERRLRQRNRLRLEEDKPAVERCLEELVFGDVE
• Quantity: 100 μg
• Research Discipline: Core ESC Like Genes, Stem Cell Markers
• Gene ID (Entrez): 51096
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS buffer, 2% sucrose
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified