Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

UTP18 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$106.19 - $352.89

Specifications

Antigen UTP18
Dilution Western Blot 1.0 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate Unconjugated
Format Purified
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NB125983
View Documents
Novus Biologicals
NBP310541100UL
100 μg
Each for $352.89
Add to cart
 
NB125984
View Documents
Novus Biologicals
NBP31054125UL
25 μg
Each for $106.19
Add to cart
 
Description

Description

UTP18 Polyclonal antibody specifically detects UTP18 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications

Specifications

UTP18
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Purified
RUO
Human
CGI-48, U3 small nucleolar RNA-associated protein 18 homolog, UTP18, small subunit (SSU) processome component, homolog (yeast), WD repeat domain 50, WD repeat-containing protein 50, WDR50
The immunogen is a synthetic peptide directed towards the N terminal region of human UTP18 (NP_057085). Peptide sequence PARPSAAAAAIAVAAAEEERRLRQRNRLRLEEDKPAVERCLEELVFGDVE
Primary
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Western Blot 1.0 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin
Unconjugated
Rabbit
Core ESC Like Genes, Stem Cell Markers
PBS buffer, 2% sucrose
51096
Polyclonal
Affinity purified
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit