PDE6C Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP198502

Catalog No. NBP198502

Description

PDE6C Polyclonal specifically detects PDE6C in Human samples. It is validated for Western Blot.

Specifications

• Antigen: PDE6C
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: cGMP phosphodiesterase 6C, COD4, EC 3.1.4, EC 3.1.4.35, PDEA2cone cGMP-specific 3'-5'-cyclic phosphodiesterase subunit alpha', phosphodiesterase 6C, cGMP-specific, cone, alpha prime
• Host Species: Rabbit
• Molecular Weight of Antigen: 99 kDa
• Quantity: 100 μL
• Research Discipline: Signal Transduction, Vision
• Gene ID (Entrez): 5146
• Target Species: Human
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_006195
• Gene Symbols: PDE6C
• Immunogen: The immunogen for this antibody is PDE6C - C-terminal region. Peptide sequence LQNNRVEWKSLADEYDAKMKVIEEEAKKQEGGAEKAAEDSGGGDDKKSKT.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.