FAM207A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP198325

Catalog No. NBP198325

Description

FAM207A Polyclonal specifically detects FAM207A in Human samples. It is validated for Western Blot.

Specifications

• Antigen: FAM207A
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: chromosome 21 open reading frame 70, hypothetical protein LOC85395, PRED56
• Host Species: Rabbit
• Molecular Weight of Antigen: 25 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: equine: 86%; Mouse: 77%; Bovine: 75%.
• Target Species: Human, Mouse, Pig, Bovine, Equine
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_478070
• Gene Symbols: FAM207A
• Immunogen: The immunogen for this antibody is FAM207A - N-terminal region. Peptide sequence AAVRPKGEAAPGPAPPAPEATPPPASAAGKDWAFINTNIFARTKIDPSAL.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 85395
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.