MED7 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP198339

Catalog No. NBP198339

Description

MED7 Polyclonal specifically detects MED7 in Human samples. It is validated for Western Blot, Chromatin Immunoprecipitation, Chromatin Immunoprecipitation (ChIP).

Specifications

• Antigen: MED7
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: Activator-recruited cofactor 34 kDa component, Cofactor required for Sp1 transcriptional activation subunit 9, cofactor required for Sp1 transcriptional activation, subunit 9 (33kD), cofactor required for Sp1 transcriptional activation, subunit 9, 33kDa, CRSP33CRSP complex subunit 9, CRSP9hMED7, mediator complex subunit 7ARC34, mediator of RNA polymerase II transcription subunit 7, MGC12284, RNA polymerase transcriptional regulation mediator subunit 7 homolog, Transcriptional coactivator CRSP33
• Host Species: Rabbit
• Molecular Weight of Antigen: 27 kDa
• Quantity: 100 μL
• Research Discipline: DNA replication Transcription Translation and Splicing
• Gene ID (Entrez): 9443
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG

• Applications: Western Blot, ChIP Assay
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Chromatin Immunoprecipitation (ChIP) 1:10-1:500
• Gene Accession No.: NP_004261
• Gene Symbols: MED7
• Immunogen: The immunogen for this antibody is MED7 - C-terminal region. Peptide sequence LASLPDDLPHSEAGMRVKTEPMDADDSNNCTGQNEHQRENSGHRRDQIIE.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.