AMGL Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP198264

Catalog No. NBP198264

Description

AMGL Polyclonal specifically detects AMGL in Human samples. It is validated for Western Blot.

Specifications

• Antigen: AMGL
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: amelogenin, Y isoform, amelogenin, Y-linked, AMGL, AMGY
• Host Species: Rabbit
• Molecular Weight of Antigen: 20 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Human: 100%; Dog: 85%; Rat: 85%; Goat: 85%; Horse: 85%; Sheep: 85%; Bovine: 85%; Mouse: 77%.
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Goat, Sheep
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q99218
• Gene Symbols: AMELY
• Immunogen: The immunogen for this antibody is AMGL C-terminal region (NP_001134). Peptide Sequence: QPMQPQPPVQPMQPLLPQPPLPPMFPLRPLPPILPDLHLEAWPATDKTKQ
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 266
• Reconstitution: Centrifuge vial prior to reconstitution. Add 50μL distilled water to a final antibody concentration of 1mg/mL.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.