Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CP2F2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier: Novus Biologicals NBP19826920UL

View more versions of this product

Catalog No. NBP19826920

$206.00 / Each of 1

Qty

Add to Cart

Description

CP2F2 Polyclonal specifically detects CP2F2 in Rat samples. It is validated for Western Blot.

Specifications

Antigen	CP2F2
Classification	Polyclonal
Dilution	Western Blot 1:1000
Gene Accession No.	NP_062176
Host Species	Rabbit
Molecular Weight of Antigen	54 kDa
Quantity	20 μL
Primary or Secondary	Primary
Content And Storage	Store at -20C. Avoid freeze-thaw cycles.

Applications	Western Blot
Conjugate	Unconjugated
Formulation	PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Symbols	Cyp2f2
Immunogen	The immunogen for this antibody is CP2F2 - middle region. Peptide sequence EHQDSLDPNSPRDFIDCFLTKMVQEKQDPLSHFNMDTLLMTTHNLLFGGT.
Purification Method	Affinity Purified
Regulatory Status	RUO
Target Species	Rat
Isotype	IgG

Product Suggestions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

Spot an opportunity for improvement?Share a Content Correction

CP2F2 Antibody, Novus Biologicals™

Description

Specifications

Product Suggestions

Documents

Promotions