Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Vanilloid R-like 3/TRPV3 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus BiologicalsSupplier Diversity Partner NBP257314

Catalog No. NBP257314


Add to cart

Description

Description

Vanilloid R-like 3/TRPV3 Polyclonal antibody specifically detects Vanilloid R-like 3/TRPV3 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
Specifications

Specifications

Vanilloid R-like 3/TRPV3
Unconjugated
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
transient receptor potential cation channel subfamily V member 3, transient receptor potential cation channel, subfamily V, member 3, TrpV3, vanilloid receptor 3, Vanilloid receptor-like 3, vanilloid receptor-related osmotically activated channel protein, VRL3, VRL-3
Rabbit
IgG
100 ul
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Polyclonal
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunocytochemistry, Immunofluorescence
Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Affinity Purified
TRPV3
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:EFEKMLPEWLRSRFRMGELCKVAEDDFRLCLRINEVKWTEWKTHVSFLNEDPGPVRRTDFNKIQDSSRNNSKTTLNAFEEVEEFPETS
Affinity purified
RUO
Primary
162514
Human
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only