Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

VARS Rabbit anti-Fungi, Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$436.00

Specifications

Antigen VARS
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 1
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP155366
View Documents
Novus Biologicals
NBP155366
100 μL
Each of 1 for $436.00
Add to cart
 
Description

Description

VARS Polyclonal specifically detects VARS in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications

Specifications

VARS
Polyclonal
Rabbit
PBS and 2% Sucrose with 0.09% Sodium Azide
EC 6.1.1, EC 6.1.1.9, G7AVARS1, Protein G7a, valine tRNA ligase 1, cytoplasmic, Valine--tRNA ligase, ValRS, valyl-tRNA synthetase, valyl-tRNA synthetase 2, VARS2valRS
Synthetic peptides corresponding to VARS(valyl-tRNA synthetase) The peptide sequence was selected from the middle region of VARS. Peptide sequence VFDEFVDMDFGTGAVKITPAHDQNDYEVGQRHGLEAISIMDSRGALINVP.
Primary
Store at -20C. Avoid freeze-thaw cycles.
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Unconjugated
RUO
P26640
7407
IgG
Affinity Purified
140 kDa
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit