Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
VGLL1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP309366100UL
Description
VGLL1 Polyclonal specifically detects VGLL1 in Human samples. It is validated for Western Blot.Specifications
VGLL1 | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
Protein TONDU, TDUtranscription cofactor vestigial-like protein 1, TONDU, vestigial like 1 (Drosophila), Vgl-1, VGL1, WUGSC:H_GS188P18.1b | |
The immunogen is a synthetic peptide directed towards the middle region of human VGLL1 (NP_057351). Peptide sequence RPQESAARENGNPGQIAGSTGLLFNLPPGSVHYKKLYVSRGSASTSLPNE | |
100 μg | |
Primary | |
Human | |
Purified |
Western Blot | |
Unconjugated | |
PBS buffer, 2% sucrose | |
Rabbit | |
Affinity purified | |
RUO | |
51442 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction