Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

VHR/DUSP3 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus BiologicalsSupplier Diversity Partner NBP257387

Catalog No. NBP257387


Add to cart

Description

Description

VHR/DUSP3 Polyclonal antibody specifically detects VHR/DUSP3 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
Specifications

Specifications

VHR/DUSP3
Unconjugated
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
dual specificity phosphatase 3, dual specificity protein phosphatase 3, Dual specificity protein phosphatase VHR, EC 3.1.3.16, EC 3.1.3.48, Vaccinia H1-related phosphatase, vaccinia virus phosphatase VH1-related, VHRserine/threonine specific protein phosphatase
Rabbit
IgG
100 ul
Cancer, Protein Phosphatase
Primary
1845
Human
Immunocytochemistry, Immunofluorescence
Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Affinity Purified
DUSP3
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LVIAYLMMRQKMDVKSALSIVRQNREIGPNDGFLAQLCQLNDRLAKEGKLKP
Affinity purified
RUO
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Polyclonal
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only