VMA21 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP15991820UL

Catalog No. NBP15991820

Description

VMA21 Polyclonal specifically detects VMA21 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: VMA21
• Classification: Polyclonal
• Dilution: Western Blot 1:100-1:2000, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
• Gene Accession No.: Q3ZAQ7
• Gene Symbols: VMA21
• Immunogen: Synthetic peptides corresponding to LOC203547(hypothetical protein LOC203547) The peptide sequence was selected from the N terminal of LOC203547. Peptide sequence MERPDKAALNALQPPEFRNESSLASTLKTLLFFTALMITVPIGLYFTTKS.
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Gene ID (Entrez): 203547
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: MEAXMGC131652, MGC125514, myopathy with excessive autophagy, Myopathy with excessive autophagy protein, vacuolar ATPase assembly integral membrane protein VMA21, VMA21 vacuolar H+-ATPase homolog (S. cerevisiae), XMEAMGC125516
• Host Species: Rabbit
• Molecular Weight of Antigen: 11 kDa
• Quantity: 20 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified