Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

VMA21 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$152.22 - $436.00

Specifications

Antigen VMA21
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Form Purified
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP15991820
View Documents
Novus Biologicals
NBP15991820UL
20 μL
Each for $152.22
Add to cart
 
NBP159918
View Documents
Novus Biologicals
NBP159918
100 μL
Each for $436.00
Add to cart
 
Description

Description

VMA21 Polyclonal specifically detects VMA21 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications

Specifications

VMA21
Polyclonal
Purified
RUO
Q3ZAQ7
203547
Synthetic peptides corresponding to LOC203547(hypothetical protein LOC203547) The peptide sequence was selected from the N terminal of LOC203547. Peptide sequence MERPDKAALNALQPPEFRNESSLASTLKTLLFFTALMITVPIGLYFTTKS.
Primary
Store at -20C. Avoid freeze-thaw cycles.
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Unconjugated
Rabbit
PBS and 2% Sucrose with 0.09% Sodium Azide
MEAXMGC131652, MGC125514, myopathy with excessive autophagy, Myopathy with excessive autophagy protein, vacuolar ATPase assembly integral membrane protein VMA21, VMA21 vacuolar H+-ATPase homolog (S. cerevisiae), XMEAMGC125516
VMA21
IgG
Protein A purified
11 kDa
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit