Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

VN1R1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP309465100UL

 View more versions of this product

Catalog No. NB123831


Add to cart

Description

Description

VN1R1 Polyclonal specifically detects VN1R1 in Human samples. It is validated for Western Blot.
Specifications

Specifications

VN1R1
Unconjugated
PBS buffer, 2% sucrose
G-protein coupled receptor GPCR24, V1RL1hGPCR24, V1R-like 1, V1r-like receptor 1, V3r-related gene protein, VNR19I1, vomeronasal 1 receptor 1, Vomeronasal olfactory receptor chromosome 19 subtype I member 1, vomeronasal olfactory receptor, (chromosome 19) subtype I, member 1, vomeronasal type-1 receptor 1, ZVNH1, ZVNR1
The immunogen is a synthetic peptide directed towards the C-terminal region of Human VN1R1 (NP_065684). Peptide sequence VQHNHSNRLSCRPSQEARATHTIMVLVSSFFVFYSVHSFLTIWTTVVANP
100 μg
Olfactory
Primary
57191
Western Blot
Western Blot 1.0 ug/ml
Purified
Rabbit
Affinity purified
RUO
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Polyclonal
Human
SDS
Documents
Product Certifications
Promotions

Promotions

Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit