VPS54 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP157579

Catalog No. NBP157579

Description

VPS54 Polyclonal specifically detects VPS54 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: VPS54
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q9P1Q0
• Gene Symbols: VPS54
• Immunogen: Synthetic peptides corresponding to VPS54(vacuolar protein sorting 54 homolog (S. cerevisiae)) The peptide sequence was selected from the N terminal of VPS54. Peptide sequence FYLPQISKEHFTVYQQEISQREKIHERCKNICPPKDTFERTLLHTHDKSR.
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 51542
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: HCC8SLP-8p, Hepatocellular carcinoma protein 8, hVps54L, Tumor antigen HOM-HCC-8, Tumor antigen SLP-8p, vacuolar protein sorting 54 (yeast), vacuolar protein sorting 54 homolog (S. cerevisiae), vacuolar protein sorting-associated protein 54, VPS54L
• Host Species: Rabbit
• Molecular Weight of Antigen: 107 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Chicken: 78%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG