Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
VPS54 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | VPS54 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP157579
|
Novus Biologicals
NBP157579 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
VPS54 Polyclonal specifically detects VPS54 in Human samples. It is validated for Western Blot.Specifications
| VPS54 | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| HCC8SLP-8p, Hepatocellular carcinoma protein 8, hVps54L, Tumor antigen HOM-HCC-8, Tumor antigen SLP-8p, vacuolar protein sorting 54 (yeast), vacuolar protein sorting 54 homolog (S. cerevisiae), vacuolar protein sorting-associated protein 54, VPS54L | |
| VPS54 | |
| IgG | |
| Affinity Purified | |
| 107 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q9P1Q0 | |
| 51542 | |
| Synthetic peptides corresponding to VPS54(vacuolar protein sorting 54 homolog (S. cerevisiae)) The peptide sequence was selected from the N terminal of VPS54. Peptide sequence FYLPQISKEHFTVYQQEISQREKIHERCKNICPPKDTFERTLLHTHDKSR. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title