WBP4 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP179489

Catalog No. NBP179489

Description

WBP4 Polyclonal antibody specifically detects WBP4 in Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish samples. It is validated for Western Blot.

Specifications

• Antigen: WBP4
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Format: Affinity Purified
• Gene Symbols: WBP4
• Immunogen: Synthetic peptide directed towards the N terminal of human WBP4. Peptide sequence: MADYWKSQPKKFCDYCKCWIADNRPSVEFHERGKNHKENVAKRISEIKQK
• Molecular Weight of Antigen: 42 kDa
• Quantity: 100 ul
• Storage Requirements: Store at -20C. Avoid freeze-thaw cycles.
• Monoclonal or Polyclonal: Polyclonal
• Test Specificity: Expected identity based on immunogen sequence: Xenopus: 85%; Chicken: 85%.
• Target Species: Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish

• Applications: Western Blot
• Dilution: Western Blot 1:1000
• Gene Accession No.: NP_009118
• Gene Alias: domain-containing binding protein 4, WW domain binding protein 4 (formin binding protein 21)
• Host Species: Rabbit
• Isotype: IgG
• Purification Method: Immunogen affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 11193
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.