Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
WBP4 Rabbit anti-Human, Polyclonal, Novus Biologicals
Rabbit Polyclonal Antibody
Manufacturer: Novus Biologicals NBP17948920UL
Description
WBP4 Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Western Blotting.Specifications
WBP4 | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
Affinity Purified | |
WBP4 | |
Synthetic peptide directed towards the N terminal of human WBP4. Peptide sequence: MADYWKSQPKKFCDYCKCWIADNRPSVEFHERGKNHKENVAKRISEIKQK | |
42 kDa | |
20ul | |
Store at -20C. Avoid freeze-thaw cycles. | |
Polyclonal | |
Human |
Western Blot | |
Western Blot 1:1000 | |
NP_009118 | |
domain-containing binding protein 4, WW domain binding protein 4 (formin binding protein 21) | |
Rabbit | |
IgG | |
Immunogen affinity purified | |
RUO | |
Primary | |
11193 |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title