Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

WBP4 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP179489

 View more versions of this product

Catalog No. NBP179489


Add to cart

Description

Description

WBP4 Polyclonal antibody specifically detects WBP4 in Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish samples. It is validated for Western Blot.
Specifications

Specifications

WBP4
Unconjugated
Affinity Purified
NP_009118
11193
Rabbit
IgG
Polyclonal
Immunogen affinity purified
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Store at -20C. Avoid freeze-thaw cycles.
Expected identity based on immunogen sequence: Xenopus: 85%; Chicken: 85%.
Western Blot
Western Blot 1:1000
PBS and 2% Sucrose with 0.09% Sodium Azide
domain-containing binding protein 4, WW domain binding protein 4 (formin binding protein 21)
WBP4
Synthetic peptide directed towards the N terminal of human WBP4. Peptide sequence: MADYWKSQPKKFCDYCKCWIADNRPSVEFHERGKNHKENVAKRISEIKQK
42 kDa
Primary
100 ul
RUO
Human,Mouse,Rat,Bovine,Canine,Equine,Guinea Pig,Rabbit,Zebrafish
SDS
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit