Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
WBP4 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $349.40
Specifications
| Antigen | WBP4 |
|---|---|
| Immunogen | Synthetic peptide directed towards the N terminal of human WBP4. Peptide sequence: MADYWKSQPKKFCDYCKCWIADNRPSVEFHERGKNHKENVAKRISEIKQK |
| Host Species | Rabbit |
| Primary or Secondary | Primary |
| Monoclonal or Polyclonal | Polyclonal |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP17948920
|
Novus Biologicals
NBP17948920UL |
20ul |
Each for $152.22
|
|
NBP179489
|
Novus Biologicals
NBP179489 |
100 ul |
Each for $349.40
|
|
Description
WBP4 Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Western Blotting.Specifications
| WBP4 | |
| Rabbit | |
| Polyclonal | |
| Unconjugated | |
| 11193 | |
| Affinity Purified | |
| Western Blot | |
| RUO |
| Synthetic peptide directed towards the N terminal of human WBP4. Peptide sequence: MADYWKSQPKKFCDYCKCWIADNRPSVEFHERGKNHKENVAKRISEIKQK | |
| Primary | |
| IgG | |
| domain-containing binding protein 4, WW domain binding protein 4 (formin binding protein 21) | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| Immunogen affinity purified | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title