Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
WDPCP Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | WDPCP |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP158008
|
Novus Biologicals
NBP158008 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
WDPCP Polyclonal specifically detects WDPCP in Human samples. It is validated for Western Blot.Specifications
| WDPCP | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| Bardet-Biedl syndrome 15 protein, BBS15C2orf86FRITZ, chromosome 2 open reading frame 86, DKFZp686C12204, fritz, FRTZ, hFrtz, WD repeat containing planar cell polarity effector, WD repeat-containing and planar cell polarity effector protein, WD repeat-containing protein C2orf86 | |
| WDPCP | |
| IgG | |
| Affinity Purified |
| Western Blot | |
| Unconjugated | |
| RUO | |
| O95876-2 | |
| 51057 | |
| Synthetic peptides corresponding to LOC51057(hypothetical protein LOC51057) The peptide sequence was selected from the N terminal of LOC51057. Peptide sequence LAQNKLCFIQFTKKMESSDVNKRLEKLSALDYKIFYYEIPGPINKTTERH. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title