Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

WDPCP Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$436.00

Specifications

Antigen WDPCP
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 1
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP158008
View Documents
Novus Biologicals
NBP158008
100 μL
Each of 1 for $436.00
Add to cart
 
Description

Description

WDPCP Polyclonal specifically detects WDPCP in Human samples. It is validated for Western Blot.
Specifications

Specifications

WDPCP
Polyclonal
Rabbit
PBS and 2% Sucrose with 0.09% Sodium Azide
Bardet-Biedl syndrome 15 protein, BBS15C2orf86FRITZ, chromosome 2 open reading frame 86, DKFZp686C12204, fritz, FRTZ, hFrtz, WD repeat containing planar cell polarity effector, WD repeat-containing and planar cell polarity effector protein, WD repeat-containing protein C2orf86
WDPCP
IgG
Affinity Purified
Western Blot
Unconjugated
RUO
O95876-2
51057
Synthetic peptides corresponding to LOC51057(hypothetical protein LOC51057) The peptide sequence was selected from the N terminal of LOC51057. Peptide sequence LAQNKLCFIQFTKKMESSDVNKRLEKLSALDYKIFYYEIPGPINKTTERH.
Primary
Store at -20C. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit