Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
WDR12 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | WDR12 |
|---|---|
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Form | Purified |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP153111
|
Novus Biologicals
NBP153111 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
WDR12 Polyclonal specifically detects WDR12 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| WDR12 | |
| Unconjugated | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| FLJ10881, FLJ12719, FLJ12720, ribosome biogenesis protein WDR12, WD repeat domain 12, WD repeat-containing protein 12, YTM1 | |
| WDR12 | |
| IgG | |
| Protein A purified |
| Polyclonal | |
| Purified | |
| RUO | |
| Q9GZL7 | |
| 55759 | |
| Synthetic peptides corresponding to WDR12 (WD repeat domain 12) The peptide sequence was selected from the C terminal of WDR12. Peptide sequence DTRSCKAPLYDLAAHEDKVLSVDWTDTGLLLSGGADNKLYSYRYSPTTSH. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title