Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

WDR12 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$436.00

Specifications

Antigen WDR12
Classification Polyclonal
Conjugate Unconjugated
Form Purified
Host Species Rabbit
View More Specs

Products 1
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP153111
View Documents
Novus Biologicals
NBP153111
100 μL
Each of 1 for $436.00
Add to cart
 
Description

Description

WDR12 Polyclonal specifically detects WDR12 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications

Specifications

WDR12
Unconjugated
Rabbit
PBS and 2% Sucrose with 0.09% Sodium Azide
FLJ10881, FLJ12719, FLJ12720, ribosome biogenesis protein WDR12, WD repeat domain 12, WD repeat-containing protein 12, YTM1
WDR12
IgG
Protein A purified
Polyclonal
Purified
RUO
Q9GZL7
55759
Synthetic peptides corresponding to WDR12 (WD repeat domain 12) The peptide sequence was selected from the C terminal of WDR12. Peptide sequence DTRSCKAPLYDLAAHEDKVLSVDWTDTGLLLSGGADNKLYSYRYSPTTSH.
Primary
Store at -20C. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit