Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

WDR13 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP15484320UL

 View more versions of this product

Catalog No. NBP15484320

Add to cart



WDR13 Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Western Blotting.


PBS and 2% Sucrose with 0.09% Sodium Azide
Synthetic peptides corresponding to WDR13 (WD repeat domain 13) The peptide sequence was selected from the N terminal of WDR13. Peptide sequence GQRYGPLSEPGSARAYSNSIVRSSRTTLDRMEDFEDDPRALGARGHRRSV.
53 kDa
Store at -20C. Avoid freeze-thaw cycles.
Western Blot
Western Blot 1:100-1:2000
DKFZp779C2057, FLJ20563, MG21, WD repeat domain 13, WD repeat-containing protein 13
Protein A purified
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit