WDR13 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP154843

Catalog No. NBP154843

Description

WDR13 Polyclonal specifically detects WDR13 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: WDR13
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q9H1Z4
• Gene Symbols: WDR13
• Immunogen: Synthetic peptides corresponding to WDR13 (WD repeat domain 13) The peptide sequence was selected from the N terminal of WDR13. Peptide sequence GQRYGPLSEPGSARAYSNSIVRSSRTTLDRMEDFEDDPRALGARGHRRSV.
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Gene ID (Entrez): 64743
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Form: Purified

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: DKFZp779C2057, FLJ20563, MG21, WD repeat domain 13, WD repeat-containing protein 13
• Host Species: Rabbit
• Molecular Weight of Antigen: 53 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.
• Isotype: IgG